CAT# | AF2382 |
Sequence | PPRPGQSKPFPTFPGHGPFNPKTQWPYPLPNPGH |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Deslorelin acetate, marketed under the trade names Ovuplant, SucroMate and Suprelorin, is an injectable gonadotr ...
The toxin BeKm 1 is a HERG-specific peptide toxin, which are voltage-gated K+ channels, coded by the human ether ...
Acid-sensitive ion channels (ASICs) are a class of proton-gated ion channels belonging to the Degenerin/Epitheli ...
Antazoline is a drug used in the treatment of atrial fibrillation (AF), and its formula is C17H19N3. In fact, th ...
L-ornithine α-ketoglutarate monohydrate, with some synonyms like OKG, OAKG and L-ornithine 2-oxoglutarate monohy ...