Home > Product > Antimicrobial Peptides > Abaecin isoform 2

Antimicrobial Peptides

Abaecin isoform 2

[Price Inquiry]
CAT#
AF2382
Sequence
PPRPGQSKPFPTFPGHGPFNPKTQWPYPLPNPGH
Host Chemicals
Bombus terrestris
Length
34
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.