Home > Product > Antimicrobial Peptides > Abaecin-like

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Abaecin-like

[Price Inquiry]
CAT#
AF2381
Sequence
PPRPGQSKPFPSFPGHGPFNPKIQWPYPLPNPGH
Host Chemicals
Bombus impatiens
Length
34
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.