Home > Product > Antimicrobial Peptides > Abaecin 1 precursor

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Abaecin 1 precursor

[Price Inquiry]
CAT#
AF2142
Sequence
QPPIRNPPPGGWKPFPTFPGQGPYNPKIRFPH
Host Chemicals
Solenopsis invicta
Length
32
Activity
Antimicrobial
SwissProt ID
I2E7P4
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.