Home > Product > Antimicrobial Peptides > Abaecin 1 precursor

Antimicrobial Peptides

Abaecin 1 precursor

Price Inquiry
CAT#
AF2142
Sequence
QPPIRNPPPGGWKPFPTFPGQGPYNPKIRFPH
Host Chemicals
Solenopsis invicta
Length
32
Activity
Antimicrobial
SwissProt ID
I2E7P4

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.