CAT# | AF3275 |
Sequence | RYCERSSGTWSGVCGNTDKCSSQCQRLEGAAHGSCNYVFPAHKCICYYPC |
Activity | Fungi, |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Background Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be acc ...
Sinapultide (also known as KL4 peptide) is a synthetic protein used to mimic human SP-B. Respiratory distress ...
In the respiratory tract, there are tachykinin P (SP) and neurokinin A (NKA) in capsaicin-sensitive primary affe ...
MEN 11270 (H-DArg-Arg-Pro-Hyp-Gly-Thi-c(Dab-Dtic-Oic-Arg)c(7γ-10α)) is a novel selective constrained peptide ant ...
Studies on the binding affinities of darifenacin hydrobromide and human muscarinic receptor subtypes show strong ...