Home > Product > Antimicrobial Peptides > Ac-AFP4

Antimicrobial Peptides

CAT#
AF3283
Sequence
QKLCERPSGTWSGVCGNNGACRNQCIRLERARHGSCNYVFPAHKCICYFPC
Host Chemicals
Heliophila coronopifolia, South Africa
Length
51
Activity
Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.