Home > Product > Antimicrobial Peptides > AC-AMP2

Antimicrobial Peptides

CAT#
AF1978
Sequence
VGECVRGRCPSGMCCSQFGYCGKGPKYCGR
Host Chemicals
Amaranthus caudatus
Length
30
Activity
Antibacterial, Antifungal
SwissProt ID
P27275, Q9S8Z7
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.