Keywords Search Google Search Search

AC-AMP2

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF1978
Sequence	VGECVRGRCPSGMCCSQFGYCGKGPKYCGR
Activity	Antibacterial, Antifungal

CAT#	Product Name	Inquiry
AF644	Retrocyclin-3	Inquiry
AF1942	Thuricin CD	Inquiry
AF1376	Defensin D5	Inquiry
AF3233	Vv-AMP1	Inquiry
AF3138	Beta-defensin 14	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of ACV 1 As A Highly Selective Antagonist

Conotoxins are small peptides of 12 to 19 amino acids, which act as highly selective antagonists of ion channel ...

The Introduction of Orexin A

Orexin A (OXA) and orexin B (OXB) are hypothalamic neuropeptides discovered in 1998, which bind to two G-protein ...

Function of lecirelin in ovarian follicular cysts

Lecirelin, a synthetic hormone, is a strongly basic nonapeptide with sequence yr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-A ...

Application of ZIP to block the constitutive activity of PKMζ

Long-term potentiation (LTP) is a persistent synaptic enhancement which is thought to be a substrate for memory. ...

The Function of Dalbavancin in Acute Bacterial Skin and Skin Tissue Infections (ABSSSI)

Dalbavancin, marketed under the brand name of Dalvance, is a new semi-synthetic glycopeptide antibiotic for anti ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Amaranthus caudatus
Length	30
SwissProt ID	P27275, Q9S8Z7