Keywords Search Google Search Search

Acidic peptide 1-2

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	B11005
Sequence	LEAAMRDLDSFEHPEEASEKETRGFNQEEKE

CAT#	Product Name	Inquiry
X00532	PH1BS005_04	Inquiry
X03762	PM_11053413	Inquiry
X13423	PM_7651398	Inquiry
X11230	PM_2477382	Inquiry
X08907	PM_17550364	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

PBP 10, a highly specific FPR2 antagonist

PBP 10 (RhoB-Glu-Arg-Leu-Phe-Glc-Val-Lys-Glc-Arg-Arg) is a 10-aa-long rhodamine-linked and membrane-permeable pe ...

KAI-1455: A selective ε-protein kinase C activator

KAI-1455, a ε-protein kinase C activator in Phase I testing for the treatment of ischemia-induced reperfusion i ...

Medicinal effect of zonisamide for seizures

Zonisamide, sold as brand name Zonegran, is a derivative of 3-(sulfamoylmethyl)-l,2-benzisoxazole. It is a membe ...

The function of Margatoxin in blocking K+ channels

Margatoxin (MgTX) is a 39 amino acid peptide with significant sequence homology to charybdotoxin (ChTX), and ha ...

Function of trifluoroacetyl tripeptide-2 in human skin

An overview of trifluoroacetyl tripeptide-2 Peptides are chains of amino acids joined by peptide bond. Peptides are mostly i ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: