CAT# | B11010 |
Sequence | LEAAVRDLDSLEHPEEASEKETRGFNQEEKE |
Length | 31 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
X07118 | PM_15520311 | Inquiry | ||
X00487 | PH1AP003_09 | Inquiry | ||
X12119 | PM_3286012 | Inquiry | ||
X07875 | PM_16366576 | Inquiry | ||
X00407 | LVSSV_muscle | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
MEN 11270 (H-DArg-Arg-Pro-Hyp-Gly-Thi-c(Dab-Dtic-Oic-Arg)c(7γ-10α)) is a novel selective constrained peptide ant ...
Obestatin is a 23-amino acid peptide hormone produced in specific epithelial cells of the stomach and small inte ...
BA 1 (DTyr-Gln-Trp-Ala-Val- Ala-His-Phe-Nle-NH2) is a potent BRS-3 agonist (IC50 = 2.52 nM) and a NMBR and GRPR ...
Zonisamide, sold as brand name Zonegran, is a derivative of 3-(sulfamoylmethyl)-l,2-benzisoxazole. It is a membe ...
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...