Home > Product > Antimicrobial Peptides > Acidocin A

Antimicrobial Peptides

Acidocin A

[Price Inquiry]
CAT#
AF3324
Sequence
KTYYGTNGVHCTKKSLWGKVRLKNVIPGTLCRKQSLPIKQDLKILLGWATGAFGKTFH
Host Chemicals
Lactobacillus acidophilus TK9201
Length
58
Activity
Gram+,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.