Home > Product > Antimicrobial Peptides > Acidocin B

Antimicrobial Peptides

Acidocin B

[Price Inquiry]
CAT#
AF3323
Sequence
IYWIADQFGIHLATGTARKLLDAVASGASLGTAFAAILGVTLPAWALAAAGALGATAA
Host Chemicals
Lactobacillus acidophilus M46
Length
58
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.