Home > Product > Catalog Peptides > Others > Acrorhagin-2a

Others

Acrorhagin-2a

[Price Inquiry]
CAT#
A29004
Sequence
TDCRFVGAKCTKANNPCVGKVCNGYQLYCPVDDDHCIMKLTFIP
Length
44
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.