Home > Product > Catalog Peptides > Others > Acrorhagin-2

Others

Acrorhagin-2

[Price Inquiry]
CAT#
A29002
Sequence
TDCRFVGAKCTKANNPCVGKVCNGYQLYCPADDDHCIMKLTFIP
Modifications
Proline amide
Length
44
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.