Home > Product > Catalog Peptides > Others > ACTH (1-39), guinea pig

Others

warning All products are for research use only. Not for human use.

ACTH (1-39), guinea pig

[Price Inquiry]
CAT#
A03024
Sequence
SYSMEHFRWGKPVGKKRRPVKVYANGAEEESAEAFPLEF
M.W/Mr.
4529.2
Molecular Formula
C206H308N56O58S
Length
39
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.