CAT# | A03024 |
M.F/Formula | C206H308N56O58S |
M.W/Mr. | 4529.2 |
Sequence | SYSMEHFRWGKPVGKKRRPVKVYANGAEEESAEAFPLEF |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Conotoxins are small peptides of 12 to 19 amino acids, which act as highly selective antagonists of ion channel ...
Corticotropin (ACTH or adrenocorticotropic hormone) is a linear coupling of 39 amino acid residues and an import ...
Dynorphin A (1-13) [Dyn-A (1-13)] is a short-chain polypeptide containing 13 amino acids and having extensive bi ...
Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...
R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...