Home > Product > Catalog Peptides > Others > ACTH (1-39), human

Others

warning All products are for research use only. Not for human use.

ACTH (1-39), human

[Price Inquiry]
CAT#
A03025
Sequence
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
M.W/Mr.
4541.1
Length
39
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.