Home > Product > Catalog Peptides > Others > ACTH (7-38), human

Others

ACTH (7-38), human

[Price Inquiry]
CAT#
A03035
Sequence
FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
M.W/Mr.
3659.2
Length
32
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.