Home > Product > Antimicrobial Peptides > AdDLP

Antimicrobial Peptides

CAT#
AF3290
Sequence
VNPSYRLDPESRPQCEAHCGQLGMRLGAIVIMGTATGCVCEPKEAATPESR
Host Chemicals
Anaeromyxobacter dehalogenans
Length
51
Activity
Parasites,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.