Home > Product > Antimicrobial Peptides > ADP-1

Antimicrobial Peptides

CAT#
AF2879
Sequence
FDNPFGCPADEGKCFDHCNNKAYDIGYCGGSYRATCVCYRK
Host Chemicals
Amblyomma hebraeum
Length
41
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.