Home > Product > Antimicrobial Peptides > ADP-2

Antimicrobial Peptides

CAT#
AF2919
Sequence
YENPYGCPTDEGKCFDRCNDSEFEGGYCGGSYRATCVCYRT
Host Chemicals
Amblyomma hebraeum
Length
41
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.