Keywords Search Google Search Search

ADP-2

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2919
Sequence	YENPYGCPTDEGKCFDRCNDSEFEGGYCGGSYRATCVCYRT
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF3249	Cathelicidin-AL	Inquiry
AF2957	Bovine Beta-defensin 5	Inquiry
AF2266	Brevinin-2SN2	Inquiry
AF1273	Brevinin-1CHa	Inquiry
AF2826	Beta-defensin 5 , BNBD-5	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of peginesatide in anemia

Peginesatide sold under the brand name Omontys, formerly Hematide, is a synthetic peptide consisting of two 21 a ...

GIP (gastric inhibitory polypeptide or glucosedependent insulinotropic peptide)

GIP is a 42-aminoacid peptide secreted from the intestinal K-cells (located mainly in the duodenum and proximal jejunum) and ...

Function of sinapultide in respiratory distress syndrome

Sinapultide (also known as KL4 peptide) is a synthetic protein used to mimic human SP-B. Respiratory distress ...

Function of leuprolide acetate in disorders of the reproductive system

Leuprolide acetate, an acetate salt with similar structure to luteinizing hormone-releasing hormone (LHRH) secre ...

An antiplatelet drug of the glycoprotein IIb/IIIa inhibitor class - Eptifibatide Acetate

Eptifibatide acetate is a white or white-off powder, soluble in water and freely soluble in 1% acetic in water, ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Amblyomma hebraeum
Length	41