Home > Product > Catalog Peptides > Others > Adrenomedullin (13-52), human

Others

Adrenomedullin (13-52), human

[Price Inquiry]
CAT#
A05001
Sequence
SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2(Disul
M.W/Mr.
4533.1
Length
50
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.