Home > Product > Catalog Peptides > Others > Adrenomedullin (26-52), human

Others

Adrenomedullin (26-52), human

[Price Inquiry]
CAT#
A05008
Sequence
LAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
M.W/Mr.
3119.5
Length
27
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.