Home > Product > Antimicrobial Peptides > Adrenomedullin

Antimicrobial Peptides

Adrenomedullin

[Price Inquiry]
CAT#
AF3299
Sequence
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY
Host Chemicals
adrenal medulla, skin, Homo sapiens
Length
52
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.