Home > Product > Catalog Peptides > Others > Adrenomedullin (1-52), porcine

Others

Adrenomedullin (1-52), porcine

[Price Inquiry]
CAT#
A05005
Sequence
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVA
M.W/Mr.
5971.7
Length
42
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.