Home > Product > Catalog Peptides > Others > Adrenomedullin (11-50), rat

Others

Adrenomedullin (11-50), rat

[Price Inquiry]
CAT#
A05007
Sequence
STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2
M.W/Mr.
4521.1
Modifications
Disulfide
Length
40
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.