Home > Product > Catalog Peptides > Others > Agouti-related Protein (AGRP) (25-82), human

Others

Agouti-related Protein (AGRP) (25-82), human

Price Inquiry
CAT#
A06003
Sequence
LAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPR
M.W/Mr.
6415.39
Molecular Formula
C279H468N80O90S1
Length
58

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.