Agouti-related Protein (AGRP) (25-82), human
Agouti-related Protein (AGRP) (25-82), human
Online Inquiry
| CAT# | A06003 |
| M.F/Formula | C279H468N80O90S1 |
| M.W/Mr. | 6415.39 |
| Sequence | One Letter Code: LAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPR
Three Letter Code: Leu-Ala-Pro-Met-Glu-Gly-Ile-Arg-Arg-Pro-Asp-Gln-Ala-Leu-Leu-Pro-Glu-Leu-Pro-Gly-Leu-Gly-Leu-Arg-Ala-Pro-Leu-Lys-Lys-Thr-Thr-Ala-Glu-Gln-Ala-Glu-Glu-Asp-Leu-Leu-Gln-Glu-Ala-Gln-Ala-Leu-Ala-Glu-Val-Leu-Asp-Leu-Gln-Asp-Arg-Glu-Pro-Arg |
| Appearance | White lyophilised solid |
| Storage | Desiccate at -20°C |
Solubility | ≥100mg/mL in H2O, Limited solubility in DMSO |
Shipping Condition | Room temperature in continental US; may vary elsewhere. |
Write a review
Ask a question
My Review for Agouti-related Protein (AGRP) (25-82), human
Required fields are marked with *
×
Ask a Question for Agouti-related Protein (AGRP) (25-82), human
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
