Home > Product > Catalog Peptides > Others > Agouti-related Protein (AGRP) (25-82), human

Others

Agouti-related Protein (AGRP) (25-82), human

[Price Inquiry]
CAT#
A06003
Sequence
LAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPR
M.W/Mr.
6415.39
Molecular Formula
C279H468N80O90S1
Length
58
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.