Home > Product > Catalog Peptides > Others > AGRP fragment (83-132), amide

Others

AGRP fragment (83-132), amide

[Price Inquiry]
CAT#
A06007
Sequence
SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGT
M.W/Mr.
5687.7
Length
42
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.