Home > Product > Antimicrobial Peptides > Ah-AMP1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3271
Sequence
LCNERPSQTWSGNCGNTAHCDKQCQDWEKASHGACHKRENHWKCFCYFNC
Host Chemicals
Horse chestnuts, Aesculus hippocastanum
Length
50
Activity
Fungi,
SwissProt ID
PDB ID: 1BK8
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.