Home > Product > Catalog Peptides > Others > [Ala11,22,28]-VIP (human, bovine, porcine, rat)

Others

warning All products are for research use only. Not for human use.

[Ala11,22,28]-VIP (human, bovine, porcine, rat)

[Price Inquiry]
CAT#
V02015
Sequence
HSDAVFTDNYARLRKQMAVKKALNSILA-NH2
M.W/Mr.
3160.72
Molecular Formula
C139H231N43O39S
Length
28
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.