β-Amyloid (1-42), (1-40), (1-46) and Fragments

[Ala18] Beta Amyloid (1-40)

[Price Inquiry]
CAT#
A13258
Sequence
DAEFRHDSGYEVHHQKLAFFAEDVGSNKGAIIGLMVGGVV
M.W/Mr.
4301.84
Molecular Formula
C192H291N53O58S1
Length
40
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.