CAT# | A13251 |
M.W/Mr. | 4215.7 |
Sequence | DAEFRHDSGYEVHHQALVFFAEDVGSNAGAIIGLMVGGVV |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The serine/threonine kinase Pim-1 plays an important role in cell cycle progression and apoptosis inhibition, re ...
An overview of Tripeptide-10 Citrulline Signal oligopeptides are commonly synthesized from portions of EMPs and from natural ...
(d(CH2)51,Tyr(Me)2,Arg8)-vasopressin, a kind of vasopressin, is a prohormone in neurons in the hypothalamus. Vas ...
Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...
of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...