Home > Product > Antimicrobial Peptides > ALL-38

Antimicrobial Peptides

CAT#
AF2693
Sequence
ALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Host Chemicals
Homo sapiens
Length
38
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.