Home > Product > Antimicrobial Peptides > Alo-3

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF2480
Sequence
CIKNGNGCQPNGSQNGCCSGYCHKQPGWVAGYCRRK
Host Chemicals
Acrocinus longimanus
Length
36
Activity
Antifungal
SwissProt ID
P83653
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.