CAT# | AF2480 |
Sequence | CIKNGNGCQPNGSQNGCCSGYCHKQPGWVAGYCRRK |
Activity | Antifungal |
Host Chemicals | Acrocinus longimanus | Length | 36 | SwissProt ID | P83653 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2816 | Phormicin peptide B | Inquiry | ||
AF3311 | Penaeidin-3m | Inquiry | ||
AF585 | RTD-1 | Inquiry | ||
AF3349 | SMAP 29, Sheep Myeloid Antimicrobial Peptide 29 | Inquiry | ||
AF464 | Fallaxidin 3.2 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Ziconotide (previously called SNX-111), currently marketed under the brand name of Prialt, is the synthetic form ...
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...
Resveratrol is also known as stilbene III. Its chemical name is (E)-3,5,4-trihydroxystilbene. It is a non-fla ...
Huwentoxin IV, a 35-amino-acid-residue polypeptide from Chinese tarantula Ornithoctonus huwena venom, is a kind ...
Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...