Home > Product > Antimicrobial Peptides > Alpha-defensin PhD-4

Antimicrobial Peptides

Alpha-defensin PhD-4

[Price Inquiry]
CAT#
AF1860
Sequence
ACYCRIPACFAGERRYGTCFYLGRVWAFCC
Host Chemicals
Papio hamadryas
Length
30
Activity
Antimicrobial
SwissProt ID
P86724
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.