Home > Product > Antimicrobial Peptides > Alpha-purothionin

Antimicrobial Peptides

Alpha-purothionin

[Price Inquiry]
CAT#
AF3155
Sequence
KSCCRSTLGRNCYNLCRARGAQKLCAGVCRCKISSGLSCPKGFPK
Host Chemicals
Triticum aestivum
Length
45
Activity
Antibacterial
SwissProt ID
P01544
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.