Home > Product > Antimicrobial Peptides > Amolopin-n2 antimicrobial peptide

Antimicrobial Peptides

Amolopin-n2 antimicrobial peptide

Price Inquiry
CAT#
AF3142
Sequence
FTMKKSLLLLFFLGTINLSLCEQERNAEEERRDDLGERQAEVEKR
Host Chemicals
Amolops loloensis
Length
45
Activity
Antimicrobial
SwissProt ID
C5H3Z4

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.