Amylin (8-37), rat

Amylin (8-37), rat is a truncated analog of native Amylin that selectively inhibits insulin-related glucose uptake and glycogen deposition in muscle tissue. Amylin (8-37), rat is a weak amylin receptor (AMY) antagonist.

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1187
CAS	138398-61-5
Synonyms/Alias	Amylin (8-37) (mouse, rat)
M.F/Formula	C₁₄₀H₂₂₇N₄₃O₄₃
M.W/Mr.	3200.61
Sequence	One Letter Code: ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 three Letter Code: Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2

CAT#	Product Name	Inquiry
R1153	ACTH 1-13	Inquiry
R1679	SLLK, Control Peptide for TSP1 Inhibitor(TFA)	Inquiry
R1178	Alisporivir intermediate-1	Inquiry
R1508	Mastoparan	Inquiry
R0855	G-Protein antagonist peptide	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.