Home > Product > Catalog Peptides > Amylins (IAPP) and Fragments > Amylin (8-37), rat

Amylins (IAPP) and Fragments

Amylin (8-37), rat

[Price Inquiry]
CAT#
A12010
Sequence
ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2
M.W/Mr.
3200.6
Molecular Formula
C140H227N43O43
Length
30
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.