CAT# | A12016 |
M.F/Formula | C167H272N52O53S2 |
M.W/Mr. | 3920.5 |
Sequence | KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Myristoyl pentapeptide-8, a cosmetic peptide, is a synthetic peptide containing arginine, aspartic acid, glycine ...
Gonadorelin hydrochloride, with the same amino acid sequence as endogenous gonadorelin, which is Pro-His-Trp-Ser ...
Background Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be acc ...
As a small actin-binding protein upregulated in highly metastatic prostate cancer cells, thymosin β15 (Tβ15) has ...
The peptide neuroprotectant Tat-NR2B9c, also known as NA-1, is a Tat peptide consisting of the nine C-terminal ...