Amylins (IAPP) and Fragments

Amylin, rat

[Price Inquiry]
CAT#
A12016
Sequence
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2
M.W/Mr.
3920.5
Molecular Formula
C167H272N52O53S2
Length
37
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.