Amyloid β Peptide (42-1)(human) is the inactive form of Amyloid β Peptide (1-42). Amyloid β Peptide (42-1) is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease.
CAT# | R1191 |
CAS | 317366-82-8 |
M.F/Formula | C₂₀₃H₃₁₁N₅₅O₆₀S |
M.W/Mr. | 4514.04 |
Sequence | One Letter Code: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD three Letter Code: Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Acetyl pepstatin, nature products of yeast fermentation, is general inhibitors of the family of aspartic proteas ...
Afamelanotide, a drug for tanning skin, is a synthetic peptide and analogue of α-melanocyte stimulating hormone. ...
What is abaloparatide? Abaloparatide (formerly known as BA058) is an investigational analog of human PTHrP (1-34) being devel ...
Nociceptin/orphanin FQ (N/OFQ) modulates various biological functions, including nociception, via selective stim ...
Muramyl dipeptide (MDP) is the smallest structural unit with immune activity in the skeleton of bacille calmette ...