β-Amyloid (1-42), (1-40), (1-46) and Fragments

warning All products are for research use only. Not for human use.

.-Amyloid (1-46)

[Price Inquiry]
CAT#
A13333
Sequence
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIV
M.W/Mr.
4926.6
Molecular Formula
C223H347N59O65S1
Length
46
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.