Home > Product > Catalog Peptides > Amyloid (APP) Precursor 770 Fragments > Amyloid Precursor Protein (APP) (741-770)

Amyloid (APP) Precursor 770 Fragments

Amyloid Precursor Protein (APP) (741-770)

[Price Inquiry]
CAT#
A13220
Sequence
AVTPEERHLSKMQQNGYENPTYKFFEQMQN
M.W/Mr.
3646.1
Length
30
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.