Home > Product > Antimicrobial Peptides > Andersonin-A peptide precursor

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Andersonin-A peptide precursor

[Price Inquiry]
CAT#
AF2848
Sequence
PLKKSLLLLFFFGTINLSLCQDETNPEEKKRDEEVAKMEE
Host Chemicals
Odorrana andersonii (golden crossband frog)
Length
40
Activity
Antimicrobial
SwissProt ID
E3SZN0
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.