Home > Product > Antimicrobial Peptides > Andersonin-C peptide precursor

Antimicrobial Peptides

Andersonin-C peptide precursor

[Price Inquiry]
CAT#
AF2424
Sequence
IFTLIKGAAKLIGKTVAKEAGKTGLELMACKITNQ
Host Chemicals
Odorrana andersonii (golden crossband frog)
Length
35
Activity
Antibacterial
SwissProt ID
E3SZN3
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.