CAT# | AF2424 |
Sequence | IFTLIKGAAKLIGKTVAKEAGKTGLELMACKITNQ |
Activity | Antibacterial |
Host Chemicals | Odorrana andersonii (golden crossband frog) | Length | 35 | SwissProt ID | E3SZN3 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF3329 | Ubiquicidin | Inquiry | ||
AF1472 | Ocellatin-1 | Inquiry | ||
AF1189 | Brevinin-1-RAB3 peptide precursor | Inquiry | ||
AF2020 | Cyclotide vibi-H | Inquiry | ||
AF2279 | Neutrophil defensin 4 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×1. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
2. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
4. High fat diet and GLP-1 drugs induce pancreatic injury in mice
5. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Astressin 2B is a peptidic antagonist to CRF2 (corticotrophin-releasing factor 2) receptor with structure of cyc ...
DAMME (DA) is a guanine, often referred to as FK 33-824 (FK), which is a long-acting enkephalin analog. Natur ...
Ecallantide, sold under the trade name Kalbitor, is a plasma kallikrein inhibitor, consisting of sixty amino aci ...
Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...
Lecirelin, a synthetic hormone, is a strongly basic nonapeptide with sequence yr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-A ...