Home > Product > Antimicrobial Peptides > Andersonin-M3 peptide precursor

Antimicrobial Peptides

Andersonin-M3 peptide precursor

[Price Inquiry]
CAT#
AF2914
Sequence
TLKKPLLVLFFLGTISLSLCEQERDADEEEGSENGAEDIKQ
Host Chemicals
Odorrana andersonii (golden crossband frog)
Length
41
Activity
Antimicrobial
SwissProt ID
E3SZQ0
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.