Keywords Search Google Search Search

Androgenic gland hormone A chain

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	A32009
Sequence	DIAFHEECCNIRTEHKCNRTTVELYCRRYSP

CAT#	Product Name	Inquiry
C5106	Z-Leu-Tyr-chloromethylketone	Inquiry
X07495	PM_1594580	Inquiry
X16204	PM_9312273	Inquiry
X01098	PH1NE017_05	Inquiry
X20738	UP_Q867W1	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Obtustatin: a potent selective α1β1 inhibitor

Obtustatin isolated from the venom of the Vipera lebetina obtusa viper is a highly potent integrin α1β1 inhibito ...

Function of ganirelix in infertility

Ganirelix, a synthetic decapeptide compound, is a gonadotrophin-releasing hormone (GnRH) antagonist preparation ...

The application of nafarelin acetate in hormonal therapy

Nafarelin acetate is a gonadotropin-releasing hormone (GnRH) agonist which is as effective as danazol in the tre ...

An undecapeptite of mollusk origin-Eledoisin

Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...

Function of sinapultide in respiratory distress syndrome

Sinapultide (also known as KL4 peptide) is a synthetic protein used to mimic human SP-B. Respiratory distress ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Length	31
Modifications	N-linked (GlcNAc...) (complex)