Home > Product > Catalog Peptides > Others > Androgenic gland hormone A chain

Others

Androgenic gland hormone A chain

[Price Inquiry]
CAT#
A32009
Sequence
DIAFHEECCNIRTEHKCNRTTVELYCRRYSP
Modifications
N-linked (GlcNAc...) (complex)
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.