Home > Product > Catalog Peptides > Others > Androgenic gland hormone B chain

Others

Androgenic gland hormone B chain

[Price Inquiry]
CAT#
A32007
Sequence
YQVEGMKSDVICADIRFTVHCICNELGRFPTARLTKPCPWPNRE
Modifications
Disulfide bond
Length
44
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.