Home > Product > Antimicrobial Peptides > Andropin

Antimicrobial Peptides

CAT#
AF2365
Sequence
IFVDVLDNVETALHNAAKAGFKLIKPIEKLIMPK
Host Chemicals
Drosophila yakuba
Length
34
Activity
Antibacterial
SwissProt ID
Q8WPA1
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.