Home > Product > Antimicrobial Peptides > Antibacterial peptide PMAP-36

Antimicrobial Peptides

Antibacterial peptide PMAP-36

[Price Inquiry]
CAT#
AF2502
Sequence
GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG
Host Chemicals
Sus scrofa
Length
36
Activity
Antibacterial
SwissProt ID
P49931
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.