Home > Product > Antimicrobial Peptides > Antibacterial protein 3 homolog

Antimicrobial Peptides

Antibacterial protein 3 homolog

[Price Inquiry]
CAT#
AF3106
Sequence
MSKLVQAISDAVQAGQNQDWAKLGTSIVGIVENGVGILGKLFGF
Host Chemicals
Staphylococcus haemolyticus (strain JCSC1435)
Length
44
Activity
Antibacterial
SwissProt ID
Q4L5M1
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.