Home > Product > Antimicrobial Peptides > Antibacterial protein 2

Antimicrobial Peptides

Antibacterial protein 2

Price Inquiry
CAT#
AF3100
Sequence
MEKIANAVKSAIEAGQNQDWTKLGTSILDIVSNGVTELSKIFGF
Host Chemicals
Staphylococcus haemolyticus
Length
44
Activity
Antibacterial
SwissProt ID
P11698

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.