Home > Product > Antimicrobial Peptides > Antibacterial protein 3

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Antibacterial protein 3

[Price Inquiry]
CAT#
AF3107
Sequence
MSKLVQAISDAVQAQQNQDWAKLGTSIVGIVENGVGILGKLFGF
Host Chemicals
Staphylococcus haemolyticus
Length
44
Activity
Antibacterial
SwissProt ID
P11699
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.