Home > Product > Antimicrobial Peptides > Antibacterial protein

Antimicrobial Peptides

Antibacterial protein

[Price Inquiry]
CAT#
AF3108
Sequence
MTGLAEAIANTVQAAQQHDSVKLGTSIVDIVANGVGLLGKLFGF
Host Chemicals
Staphylococcus aureus subsp. aureus USA300_FPR3757
Length
44
Activity
Antimicrobial
SwissProt ID
Q2FHR3
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.