Home > Product > Antimicrobial Peptides > Antibacterial protein

Antimicrobial Peptides

Antibacterial protein

Price Inquiry
CAT#
AF3108
Sequence
MTGLAEAIANTVQAAQQHDSVKLGTSIVDIVANGVGLLGKLFGF
Host Chemicals
Staphylococcus aureus subsp. aureus USA300_FPR3757
Length
44
Activity
Antimicrobial
SwissProt ID
Q2FHR3

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.